The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the RESP18 domain shown below is 5e-10.
MSQGLSWHDDLTQHVISQEMERIPRLRPPEPHPRDRSGLVPRKPGPAGELLTQGNPTGSS
PA
RESP18
SMART accession number:
SM01305
Description:
This domain is found in the glucocorticoid-responsive protein regulated endocrine-specific protein 18 (RESP18) and in the N-terminal extracellular region of receptor-type tyrosine-protein phosphatases containing the protein-tyrosine phosphatase receptor IA-2 domain (PFAM: PF11548).PMID:21104147; PMID:17951542
Family alignment:
There are 858 RESP18 domains in 855 proteins in SMART's nrdb database.
Click on the following links for more information.
Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing RESP18 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with RESP18 domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing RESP18 domain in the selected taxonomic class.
Literature (relevant references for this domain)
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
Requirement of regulated endocrine-specific protein-18 for development andexpression of regulated endocrine-specific protein-18 isoform c in mice.
Mol Biol Rep. 2011; 38: 2557-62
Display abstract
Regulated endocrine-specific protein-18 (RESP18) is distributed mainly in theperipheral endocrine and neuroendocrine tissues. The expression of RESP18 proteinis regulated by physiological factors, such as blood glucose or dopaminergicdrugs, but its functions remain unclear. In this study, to explore the biologicalfunctions of RESP18 in vivo, we generated RESP18 heterozygous deficient mice, andfurther found RESP18 was essential for embryonic development. In addition, wecloned a new isoform of mouse RESP18 by reverse transcription-polymerase chainreaction (RT-PCR), and denominated it as RESP18-c. Mouse RESP18-c, by skippingexon4 (43 bp in length), encodes a shorter protein of 120 amino acid residues.The distribution of RESP18-c mRNA is similar with that of RESP18 mRNA in theperipheral tissues and brains of mice.
RESP18, a homolog of the luminal domain IA-2, is found in dense core vesicles in pancreatic islet cells and is induced by high glucose.
J Endocrinol. 2007; 195: 313-21
Display abstract
The regulated endocrine-specific protein, RESP18, first found in the ratpituitary, was thought to be regulated by dopaminergic drugs. Bioinformaticsstudies showed that RESP18 shares sequence homology with the luminal region ofIA-2, a dense core vesicle (DCV) transmembrane protein involved in insulinsecretion. The present study was initiated to examine the genomic structure andsubcellular localization of RESP18 and the effect of glucose on its expression.Human RESP18 was isolated from a pancreas cDNA library and its subcellularlocalization was determined by immunoelectron microscopy. MIN6 cells and mouseislets were used to study the effect of glucose on RESP18 expression.Bioinformatics analysis revealed that RESP18 and IA-2 are tandemly arrangedwithin a 45 kb region on human chromosome 2 and share common intron-exonboundaries. By confocal microscopy, RESP18 was found in alpha, beta and deltacells in the pancreatic islets. Electron microscopy revealed that RESP18 ispresent in the lumen of DCVs. The expression of RESP18 in beta cells is markedly increased following exposure to high glucose and also elevated in the islets ofdiabetic, but not non-diabetic, NOD mice. We conclude that RESP18 is a luminalprotein of DCVs and its expression is regulated by exposure to glucose.
Links (links to other resources describing this domain)