The domain within your query sequence starts at position 12 and ends at position 136; the E-value for the RWD domain shown below is 3.17e-24.

SELDLLASMFPSENELIVNDQLALAELKDCIEKRTMEGRSSQVYFTINVSLDLSEAAVVT
FSLSCILPFKYPTVLPEITVRSVSLSRSQQTQLNTDLIAYLQKNCLGDVCILNATEWVKE
HAFDY

RWD

RWD
SMART accession number:SM00591
Description: domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain
Interpro abstract (IPR006575):

The RWD domain is a conserved region of about 110 amino acid residues, which has been identified in the mouse GCN2 eIF2alpha kinase and histidyl-tRNA synthetase and in presumed orthologues in other eukaryotic species from yeast to vertebrates. Additionally, it is also found in WD repeat containing proteins, yeast DEAD (DEXD)-like helicases, many RING-finger containing proteins, the UPF0029 uncharacterised protein family and a range of hypothetical proteins. The RWD domain has been named after the better characterised RING finger and WD repeat containing proteins and DEAD-like helicases. It has been proposed that the RWD domain might have a function in protein interaction [ (PUBMED:11779830) ].

The RWD domain is predicted to have an alpha/beta secondary structure and is thought to be related to ubiquitin-conjugating enzymes (UBCc) domain, although the catalytic cysteine critical for ubiquitin-conjugating activity is not conserved in most members of the novel subfamily [ (PUBMED:11779830) ].

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 9749 RWD domains in 9719 proteins in SMART's nrdb database.

Click on the following links for more information.