The domain within your query sequence starts at position 338 and ends at position 428; the E-value for the Rtt106 domain shown below is 4.76e-41.

AQCITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQ
GTQYTFSSIEREEYGKLFDFVNAKKLNIKNR

Rtt106

Histone chaperone Rttp106-like
Rtt106
SMART accession number:SM01287
Description: This family includes Rttp106, a histone chaperone involved in heterochromatin-mediated silencing PMID:16157874. This domain belongs to the Pleckstrin homology domain superfamily.
Interpro abstract (IPR013719):

This is a domain of unknown function that is associated with a number of different protein families. It is found in Rtt106p, which is a histone chaperone involved in heterochromatin-mediated silencing [ (PUBMED:16157874) ]. It is also found in genes annotated as metallopeptidases and various FACT complex subunits.

Family alignment:
View or

There are 3948 Rtt106 domains in 3945 proteins in SMART's nrdb database.

Click on the following links for more information.