The domain within your query sequence starts at position 292 and ends at position 351; the E-value for the SAF domain shown below is 2.38e-3.

GKSVVAKVKIPAGTTLTLDMLTVKVGEPKGYPPEDIFNLAGKKVLVTIEEDDTVMEESVE

SAF

SAF
SMART accession number:SM00858
Description: This domain family includes a range of different proteins. Such as antifreeze proteins and flagellar FlgA proteins, and CpaB pilus proteins.
Interpro abstract (IPR013974):

This entry includes a range of different proteins, such as antifreeze proteins, flagellar FlgA proteins, and CpaB pilus proteins [ (PUBMED:15146494) ].

Family alignment:
View or

There are 37399 SAF domains in 37268 proteins in SMART's nrdb database.

Click on the following links for more information.