The domain within your query sequence starts at position 292 and ends at position 351; the E-value for the SAF domain shown below is 2.38e-3.
GKSVVAKVKIPAGTTLTLDMLTVKVGEPKGYPPEDIFNLAGKKVLVTIEEDDTVMEESVE
SAF |
---|
SMART accession number: | SM00858 |
---|---|
Description: | This domain family includes a range of different proteins. Such as antifreeze proteins and flagellar FlgA proteins, and CpaB pilus proteins. |
Interpro abstract (IPR013974): | This entry includes a range of different proteins, such as antifreeze proteins, flagellar FlgA proteins, and CpaB pilus proteins [ (PUBMED:15146494) ]. |
Family alignment: |
There are 37399 SAF domains in 37268 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)