The domain within your query sequence starts at position 87 and ends at position 170; the E-value for the SAM_PNT domain shown below is 3.35e-43.

FSGFQKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLHQFGMNGQMLCNLGKER
FLELAPDFVGDILWEHLEQMIKEN

SAM_PNT

SAM / Pointed domain

• SMART accession number: SM00251
• Description: A subfamily of the SAM domain
• Interpro abstract (IPR003118):

  The highly conserved PNT (or Pointed) domain is found within a subset of the Ets transcription factors, including mammalian Ets-1, Ets-2, Erg, Fli-1, GABPalpha, and Tel, as well as Drosophila Pnt-P2 and Yan. The PNT domain is structurally related to the larger group of SAM domains through a common tertiary arrangement of four alpha-helices. A role in protein-protein association has been established for the PNT domain [ (PUBMED:10828014) (PUBMED:15351649) ].

• GO function: sequence-specific DNA binding (GO:0043565)

There are 5576 SAM_PNT domains in 5570 proteins in SMART's nrdb database.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
100.00	map04320	Dorso-ventral axis formation

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with SAM_PNT domain which could be assigned to a KEGG orthologous group, and not all proteins containing SAM_PNT domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of SAM_PNT domains in PDB

PDB code	Title
1ji7	Crystal Structure of TEL SAM Polymer
1lky	Structure of the wild-type TEL-SAM polymer
1sv0	Crystal Structure Of Yan-SAM/Mae-SAM Complex
1sv4	Crystal Structure of Yan-SAM
1sxd	Solution Structure of the Pointed (PNT) Domain from mGABPa
1sxe	The solution structure of the Pointed (PNT) domain from the transcrition factor Erg
1x66	Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1 transcription factor
2dkx	Solution structure of the SAM_PNT-domain of ETS transcription factor PDEF (Prostate ets)
2e8p	Solution structure of the N-terminal SAM-domain of E74-like factor 3
2jv3	Ets-1 PNT domain (29-138) NMR structure ensemble
2kmd	Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to co-activator CBP
2qar	Structure of the 2TEL crystallization module fused to T4 lysozyme with a helical linker.
2qb0	Structure of the 2TEL crystallization module fused to T4 lysozyme with an Ala-Gly-Pro linker.
2qb1	2TEL crystallization module
2ytu	Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1 transcription factor
4mhv	Crystal structure of the PNT domain of human ETS2

Links (links to other resources describing this domain)

• INTERPRO: IPR003118