SMART: SCOP domain d153l_

The domain within your query sequence starts at position 39 and ends at position 213; the E-value for the d153l__ domain shown below is 5e-45.

GCYGDIMTMETFGAPCDINNLMNCGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPAL
IAAIISRESHGGAVLQNGWDHKGQRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIK
AMKRKFPTWNTAQQLKGGLTAFKSGMETIVTPADIDGDLVDDVLARAKFYKRHGF

The domain within your query sequence starts at position 39 and ends at position 213; the E-value for the d153l__ domain shown below is 5e-45.

This is a SCOP domain - please see the SCOP entry of d153l__ for further annotation