SMART: SCOP domain d1a4ya

The domain within your query sequence starts at position 267 and ends at position 429; the E-value for the d1a4ya_ domain shown below is 3e-7.

NSTRLDEENISRFISRLPKFHCLQNLYVNDITLLGNNLKDFLRCLGKPLETLCLTSCDLS
QSDLDYLPCCQNTSALKRLNLTATSLRGLVFHPLGVLLESVRGTLQSLELELCFMEDSQI
SAILPALSQCSHLTKVNFYDNELSLPILRQLLYHTANLSQLTY

The domain within your query sequence starts at position 267 and ends at position 429; the E-value for the d1a4ya_ domain shown below is 3e-7.

This is a SCOP domain - please see the SCOP entry of d1a4ya_ for further annotation