SMART: SCOP domain d1b3ua

The domain within your query sequence starts at position 275 and ends at position 439; the E-value for the d1b3ua_ domain shown below is 2e-3.

QENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGW
TMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLL
TLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSR

The domain within your query sequence starts at position 275 and ends at position 439; the E-value for the d1b3ua_ domain shown below is 2e-3.

This is a SCOP domain - please see the SCOP entry of d1b3ua_ for further annotation