SMART: SCOP domain d1cnt1

The domain within your query sequence starts at position 21 and ends at position 197; the E-value for the d1cnt1_ domain shown below is 1e-60.

PHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAG
LPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVL
AALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQL

The domain within your query sequence starts at position 21 and ends at position 197; the E-value for the d1cnt1_ domain shown below is 1e-60.

This is a SCOP domain - please see the SCOP entry of d1cnt1_ for further annotation