SMART: SCOP domain d1crza1

The domain within your query sequence starts at position 21 and ends at position 169; the E-value for the d1crza1 domain shown below is 5e-4.

NPVNCVFFDEANKQVFAVRSGGATGVVVKGPDDRNPISFRMDDRGEVKCIKFSLENKILA
VQRTAKAVDFCNFIPDNSQLEYTQECKTKNANILGFCWTSSTEIVFITDQGIEFYQVMPE
KRSLKLLKSHNINVNWYTYCPESAVILLS

The domain within your query sequence starts at position 21 and ends at position 169; the E-value for the d1crza1 domain shown below is 5e-4.

This is a SCOP domain - please see the SCOP entry of d1crza1 for further annotation