SMART: SCOP domain d1d4oa

The domain within your query sequence starts at position 656 and ends at position 832; the E-value for the d1d4oa_ domain shown below is 1e-102.

GTHTEINLDNAVEMIREANSIVITPGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVA
GRMPGQLNVLLAEAGVPYDIVLEMDEINSDFPDTDLVLVIGANDTVNSAAQEDPNSIIAG
MPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKVRES

The domain within your query sequence starts at position 656 and ends at position 832; the E-value for the d1d4oa_ domain shown below is 1e-102.

This is a SCOP domain - please see the SCOP entry of d1d4oa_ for further annotation