SMART: SCOP domain d1e9la1

The domain within your query sequence starts at position 83 and ends at position 236; the E-value for the d1e9la1 domain shown below is 2e-16.

VLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKH
AKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQ
KHVGLIHMLTHLAEALHQARLLVILVIPPAVTPG

The domain within your query sequence starts at position 83 and ends at position 236; the E-value for the d1e9la1 domain shown below is 2e-16.

This is a SCOP domain - please see the SCOP entry of d1e9la1 for further annotation