SMART: SCOP domain d1gt91

The domain within your query sequence starts at position 780 and ends at position 951; the E-value for the d1gt91_ domain shown below is 9e-3.

WAAQYREAVEMDIQAAAVAVAEAKARAEARAQMGIGEEAVAGPWNWDDMDINCLTSGGPS
TGAGFCSGPSTGGFGGGPSTGPGFGGPSTGPGFGGPSTGGGFGGPNTGGGFGGPSTGGGF
GGPSTGGGFGGPSTGGGFGGPSTAAGFGSGLSTSTGFGGGLNTSAGFSGGPP

The domain within your query sequence starts at position 780 and ends at position 951; the E-value for the d1gt91_ domain shown below is 9e-3.

This is a SCOP domain - please see the SCOP entry of d1gt91_ for further annotation