SMART: SCOP domain d1ihga1

The domain within your query sequence starts at position 170 and ends at position 322; the E-value for the d1ihga1 domain shown below is 1e-14.

MTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQ
ITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFA
KVLELDPALAPVVSRELRALETRIRQKDEEDKA

The domain within your query sequence starts at position 170 and ends at position 322; the E-value for the d1ihga1 domain shown below is 1e-14.

This is a SCOP domain - please see the SCOP entry of d1ihga1 for further annotation