The domain within your query sequence starts at position 16 and ends at position 48; the E-value for the d1knga_ domain shown below is 2e-3.

ACAQSEQDFYDFKAVNIRGKLVSLEKYRGSRLL

This is a SCOP domain - please see the SCOP entry of d1knga_ for further annotation