SMART: SCOP domain d1m1xa2

The domain within your query sequence starts at position 629 and ends at position 786; the E-value for the d1m1xa2 domain shown below is 5e-32.

DNVCNSNLKLEYKFGTREGNQDKFSYLPIQKGIPELVLKDQKDIALEITVTNSPSDPRNP
RKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSS
VTFYLILSTTEVTFDTTDLDINLKLETTSNQDNLAPIT

The domain within your query sequence starts at position 629 and ends at position 786; the E-value for the d1m1xa2 domain shown below is 5e-32.

This is a SCOP domain - please see the SCOP entry of d1m1xa2 for further annotation