SMART: SCOP domain d1qbkb

The domain within your query sequence starts at position 1 and ends at position 168; the E-value for the d1qbkb_ domain shown below is 4e-9.

DVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLC
LRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDI
LRCFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDETGSH

The domain within your query sequence starts at position 1 and ends at position 168; the E-value for the d1qbkb_ domain shown below is 4e-9.

This is a SCOP domain - please see the SCOP entry of d1qbkb_ for further annotation