The domain within your query sequence starts at position 31 and ends at position 90; the E-value for the SCY domain shown below is 4.63e-32.

PLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNL

SCY

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC).		 SCY
SMART accession number:SM00199
Description: Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.
Interpro abstract (IPR001811):

Many low-molecular weight factors secreted by cells including fibroblasts, macrophages and endothelial cells, in response to a variety of stimuli such as growth factors, interferons, viral transformation and bacterial products, are structurally related [ (PUBMED:1910690) (PUBMED:2149646) (PUBMED:2687068) ]. Most members of this family of proteins seem to have mitogenic, chemotactic or inflammatory activities. These small cytokines are also called intercrines or chemokines. They are cationic proteins of 70 to 100 amino acid residues that share four conserved cysteine residues involved in two disulphide bonds, as shown in the following schematic representation: 


                             +------------------------------------+
                             |                                    |
     xxxxxxxxxxxxxxxxxxxxxxCxCxxxxxxxxxxxxxxxxxxxxxxxCxxxxxxxxxxxxCxxxxx
                           |                         |
                           +-------------------------+

'C': conserved cysteine involved in a disulphide bond.

Chemokines can be sorted into main groups based on the spacing of the two amino-terminal cysteines. In the first group (see IPR001089 ), the two cysteines are separated by a single residue (C-x-C), while in the second group (see IPR000827 ), they are adjacent (C-C).

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:chemokine activity (GO:0008009)
Family alignment:
View or

There are 9048 SCY domains in 8975 proteins in SMART's nrdb database.

Click on the following links for more information.