The domain within your query sequence starts at position 1 and ends at position 193; the E-value for the SF_P domain shown below is 7.3e-150.
MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHM SQKHTEMVLEMSIGAPETQKRLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTY CYIMKMAPESIPSLEAFARKLQNFQAKPSTPTSKLGQEEGHDTGSESDSSGRDLAFLGLA VSTLCGELPLYYI
SF_PPulmonary surfactant proteins |
---|
SMART accession number: | SM00019 |
---|---|
Description: | Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines |
Interpro abstract (IPR001729): | Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines [ (PUBMED:2326260) (PUBMED:2015882) ]. |
GO process: | respiratory gaseous exchange by respiratory system (GO:0007585) |
GO component: | extracellular region (GO:0005576) |
Family alignment: |
There are 68 SF_P domains in 68 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Disease (disease genes where sequence variants are found in this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)