The domain within your query sequence starts at position 444 and ends at position 617; the E-value for the SRA domain shown below is 2.82e-77.

PSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFEDEVDRG
DEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPV
RVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVE

SRA

SET and RING finger associated domain. Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533.

• SMART accession number: SM00466
• Description: Domain in SET domain containing proteins and in Deinococcus radiodurans DRA1533.
• Interpro abstract (IPR003105):

  This domain has been termed SRA-YDG, for SET and Ring finger Associated, and because of the conserved YDG motif within the domain. Further characteristics of the domain are the conservation of up to 13 evenly spaced glycine residues and a VRV(I/V)RG motif. The domain is mainly found in plants and animals and in bacteria. In animals, this domain is associated with the Np95-like ring finger protein and the related gene product Np97, which contains PHD and RING FINGER domains and which is an important determinant in cell cycle progression. Np95 is a chromatin-associated ubiquitin ligase, binding to histones is direct and shows a remarkable preference for histone H3 and its N-terminal tail. The SRA-YDG domain contained in Np95 is indispensable both for the interaction with histones and for chromatin binding in vivo [ (PUBMED:9880673) (PUBMED:14993289) ]. In plants the SRA-YDG domain is associated with the SET domain, found in a family of histone methyl transferases, and in bacteria it is found in association with HNH, a non-specific nuclease motif [ (PUBMED:14993289) (PUBMED:11691919) ].

There are 1840 SRA domains in 1831 proteins in SMART's nrdb database.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
100.00	map00380	Tryptophan metabolism

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with SRA domain which could be assigned to a KEGG orthologous group, and not all proteins containing SRA domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of SRA domains in PDB

PDB code	Title
2pb7	Crystal Structure of the SRA domain of the human UHRF1 protein
2zkd	Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2zke	Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2zkf	Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2zkg	Crystal structure of unliganded SRA domain of mouse Np95
2zo0	mouse NP95 SRA domain DNA specific complex 1
2zo1	Mouse NP95 SRA domain DNA specific complex 2
2zo2	Mouse NP95 SRA domain non-specific DNA complex
3bi7	Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
3clz	The set and ring associated (SRA) domain of UHRF1 bound to methylated DNA
3dwh	Structural and Functional Analysis of SRA domain
3f8i	Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group P21
3f8j	Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group C222(1)
3fde	Mouse UHRF1 SRA domain bound with hemi-methylated CpG DNA, crystal structure in space group C222(1) at 1.4 A resolution
3oln	Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
3q0b	Crystal structure of SUVH5 SRA- fully methylated CG DNA complex in space group P42212
3q0c	Crystal structure of SUVH5 SRA-fully methylated CG DNA complex in space group P6122
3q0d	Crystal structure of SUVH5 SRA- hemi methylated CG DNA complex
3q0f	Crystal structure of SUVH5 SRA- methylated CHH DNA complex
4nj5	Crystal structure of SUVH9
4pw5	structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
4pw6	structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
4pw7	structure of UHRF2-SRA in complex with a 5mC-containing DNA
4qen	4QEN
4qeo	4QEO
4qep	4QEP
4ygi	4YGI

Links (links to other resources describing this domain)

• INTERPRO: IPR003105