The domain within your query sequence starts at position 12 and ends at position 78; the E-value for the TAF domain shown below is 1.44e-35.

TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDI
DYALKLK

TAF

TATA box binding protein associated factor
TAF
SMART accession number:SM00803
Description: TAFs (TATA box binding protein associated factors) are part of the transcription initiation factor TFIID multimeric protein complex. TFIID is composed of the TATA box binding protein (TBP) and a number of TAFs. The TAFs provide binding sites for many different transcriptional activators and co-activators that modulate transcription initiation by Pol II. TAF proteins adopt a histone-like fold.
Interpro abstract (IPR004823):

The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex. TFIID plays a central role in mediating promoter responses to various activators and repressors. It binds tightly to TAFII-250 and directly interacts with TAFII-40. TFIID is composed of TATA binding protein (TBP)and a number of TBP-associated factors (TAFS). TAF proteins adopt a histone-like fold.

GO process:DNA-templated transcription, initiation (GO:0006352)
Family alignment:
View or

There are 1736 TAF domains in 1726 proteins in SMART's nrdb database.

Click on the following links for more information.