The domain within your query sequence starts at position 36 and ends at position 107; the E-value for the TEA domain shown below is 4.84e-52.

DGSPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTR
TRKQVSSHIQVL

TEA

TEA domain
TEA
SMART accession number:SM00426
Description: -
Interpro abstract (IPR000818):

The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and abaA. The TEA domain is located toward the amino terminus of eukaryotic transcription factors of the TEA/ATTS family. It is predicted to contain three alpha-helices, two of which have been demonstrated to be important for DNA binding [ (PUBMED:8389695) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:
View or

There are 1531 TEA domains in 1530 proteins in SMART's nrdb database.

Click on the following links for more information.