The domain within your query sequence starts at position 1074 and ends at position 1109; the E-value for the TECPR domain shown below is 1.59e-2.

SSWEHVSNNVRKVSVGPLDQVWVIANKVQGSHGLSR

TECPR

Beta propeller repeats in Physarum polycephalum tectonins, Limulus lectin L-6 and animal hypothetical proteins.
TECPR
SMART accession number:SM00706
Description: -
Interpro abstract (IPR006624):

Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are found in L-6, a bacterial lipopolysaccharide-binding lectin from horseshoe crab hemocytes. The repetitive sequences of the tectonins and L-6 are reminiscent of the WD repeats of the beta-subunit of G proteins, suggesting that they form beta-propeller domains. The tectonins may be lectins that function as part of a transmembrane signalling complex during phagocytosis [ (PUBMED:9497393) ]. It has been demonstrated that tectonin beta-propeller repeat-containing protein 1 (TECPR1) has a critical function during autophagosome maturation and autophagosome-lysosome fusion [ (PUBMED:22342342) ].

Family alignment:
View or

There are 16106 TECPR domains in 2266 proteins in SMART's nrdb database.

Click on the following links for more information.