The domain within your query sequence starts at position 265 and ends at position 356; the E-value for the TGFB domain shown below is 5.78e-7.

CCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMT
SLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCA

TGFB

Transforming growth factor-beta (TGF-beta) family
TGFB
SMART accession number:SM00204
Description: Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types.
Interpro abstract (IPR001839):

Transforming growth factor-beta (TGF-beta) is a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types. TGF-beta-1 is a peptide of 112 amino acid residues derived by proteolytic cleavage from the C-terminal of a precursor protein [ (PUBMED:8679613) ].

A number of proteins are known to be related to TGF-beta-1 [ (PUBMED:1575734) (PUBMED:8199356) ]. Proteins from the TGF-beta family are only active as homo- or heterodimer; the two chains being linked by a single disulphide bond. From X-ray studies of TGF-beta-2 [ (PUBMED:1631557) ], it is known that all the other cysteines are involved in intrachain disulphide bonds. There are four disulphide bonds in the TGF-beta's and in inhibin beta chains, while the other members of this family lack the first bond.

The regulatory cytokine TGFbeta exerts tumour-suppressive effects, but also modulates cell invasion and immune regulation [ (PUBMED:18662538) ]. Misregulation of the TGF-beta signalling pathway can result in tumour development.

GO function:growth factor activity (GO:0008083)
Family alignment:
View or

There are 13842 TGFB domains in 13809 proteins in SMART's nrdb database.

Click on the following links for more information.