The domain within your query sequence starts at position 166 and ends at position 367; the E-value for the TLC domain shown below is 6.52e-57.

QKFQESCWRFTFYLLITMAGAVFLYDKPWAYDLWEVWNDYPRQPLLPSQYWYYILEMSFY
WSLVFSLSTDIKRKDFLAHVIHHLAAISLMSFSWCANYIRSGTLVMFIHDISDIWLESAK
MFSYAGWKQTCNTLFFIFTVVFFISRFIIFPFWILYCTLILPLHYLEPFFSYIFLNLQLM
ILQGLHVYWGYFILKMLNRCIF

TLC

TRAM, LAG1 and CLN8 homology domains.
TLC
SMART accession number:SM00724
Description: Protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis, TRAM is a subunit of the translocon and the CLN8 gene is mutated in Northern epilepsy syndrome. The family may possess multiple functions such as lipid trafficking, metabolism, or sensing. Trh homologues possess additional homeobox domains.
Interpro abstract (IPR006634):

TLC is a protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis [ (PUBMED:11694577) ], TRAM is a subunit of the translocon and the CLN8 gene is mutated in Northern epilepsy syndrome. Proteins containing this domain may possess multiple functions such as lipid trafficking, metabolism, or sensing. Trh homologues possess additional homeobox domains [ (PUBMED:9872981) ].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 11135 TLC domains in 11114 proteins in SMART's nrdb database.

Click on the following links for more information.