The domain within your query sequence starts at position 119 and ends at position 186; the E-value for the TPK_B1_binding domain shown below is 5.12e-17.
GKHRLHVDTGMEGSWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLV TVETDHPL
TPK_B1_bindingThiamin pyrophosphokinase, vitamin B1 binding domain |
---|
SMART accession number: | SM00983 |
---|---|
Description: | Thiamin pyrophosphokinase (TPK) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis (PUBMED:11435118). |
Interpro abstract (IPR007373): | Thiamin pyrophosphokinase (TPK, EC 2.7.6.2 ) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis [ (PUBMED:11435118) ]. |
GO process: | thiamine diphosphate biosynthetic process (GO:0009229) |
GO function: | thiamine binding (GO:0030975) |
Family alignment: |
There are 7992 TPK_B1_binding domains in 7991 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)