The domain within your query sequence starts at position 168 and ends at position 235; the E-value for the TPK_B1_binding domain shown below is 5.12e-17.

GKHRLHVDTGMEGSWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLV
TVETDHPL

TPK_B1_binding

Thiamin pyrophosphokinase, vitamin B1 binding domain
TPK_B1_binding
SMART accession number:SM00983
Description: Thiamin pyrophosphokinase (TPK) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis (PUBMED:11435118).
Interpro abstract (IPR007373):

Thiamin pyrophosphokinase (TPK, EC 2.7.6.2 ) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis [ (PUBMED:11435118) ].

GO process:thiamine diphosphate biosynthetic process (GO:0009229)
GO function:thiamine binding (GO:0030975)
Family alignment:
View or

There are 7992 TPK_B1_binding domains in 7991 proteins in SMART's nrdb database.

Click on the following links for more information.