The domain within your query sequence starts at position 11 and ends at position 141; the E-value for the Telo_bind domain shown below is 3.6e-53.

YTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALP
IIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQ
KMVEALRVWAS

Telo_bind

Telomeric single stranded DNA binding POT1/CDC13
Telo_bind
SMART accession number:SM00976
Description: The telomere-binding protein forms a heterodimer in ciliates consisting of an alpha and a beta subunit. This complex may function as a protective cap for the single-stranded telomeric overhang. Alpha subunit consists of 3 structural domains, all with the same beta-barrel OB fold.
Interpro abstract (IPR011564):

This domain binds single stranded telomeric DNA and adopts an OB fold [ (PUBMED:11935027) ]. It includes the proteins POT1 and Cdc13 which have been shown to regulate telomere length, replication and capping [ (PUBMED:11230149) (PUBMED:18066078) (PUBMED:16943437) ]. POT1 is one component of the shelterin complex that protects telomere-ends from attack by DNA-repair mechanisms [ (PUBMED:1239117) (PUBMED:19228335) ].

GO process:telomere maintenance (GO:0000723)
GO component:nuclear chromosome, telomeric region (GO:0000784)
GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 1021 Telo_bind domains in 1020 proteins in SMART's nrdb database.

Click on the following links for more information.