The domain within your query sequence starts at position 140 and ends at position 169; the E-value for the YL1_C domain shown below is 2.99e-9.

KYSDISGLLANYTDPQSKLRFSTVEEFSYI

YL1_C

YL1 nuclear protein C-terminal domain
YL1_C
SMART accession number:SM00993
Description: This domain is found in proteins of the YL1 family. These proteins have been shown to be DNA-binding and may be a transcription factor. This domain is found in proteins that are not YL1 proteins.
Interpro abstract (IPR013272):

This domain is found at the C terminus in proteins of the Vps72/YL1 family [ (PUBMED:7702631) ]. These proteins are involved in chromatin remodelling [ (PUBMED:23580526) (PUBMED:15528408) ]. This domain is also found in proteins that do not belong to the Vps72/YL1 family.

Family alignment:
View or

There are 2828 YL1_C domains in 2824 proteins in SMART's nrdb database.

Click on the following links for more information.