The domain within your query sequence starts at position 1 and ends at position 108; the E-value for the btg1 domain shown below is 7.37e-64.
MRDEIATAVFFVTRLVKKHEKLSTQQIETFALKLMTILFEKYRGHWHPDCPSKGQAFRCI RINNNENKDPVLERACAESNVNFFHLGLPKEMTIWVDPYEVCCRYGEK
btg1tob/btg1 family |
---|
SMART accession number: | SM00099 |
---|---|
Description: | The tob/btg1 is a family of proteins that inhibit cell proliferation. |
Interpro abstract (IPR002087): | This entry represents a conserved domain found in the N-terminal of the BTG family members (also known as anti-proliferative proteins). In mammals, BTG family comprises six proteins: BTG1, BTG2/PC3/Tis21, BTG3/ANA, BTG4/PC3B, Tob1/Tob and Tob2. They regulate cell cycle progression in a variety of cell types [ (PUBMED:19746446) ]. These proteins have from 158 to 363 amino acid residues, that are highly similar and include 3 conserved cysteine residues. BTG2 seems to have a signal sequence; while the other proteins may lack such a domain. |
Family alignment: |
There are 1150 btg1 domains in 1147 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)