The domain within your query sequence starts at position 141 and ends at position 233; the E-value for the c-SKI_SMAD_bind domain shown below is 2.48e-56.
AFDVVHECAWGSRGSFIPARYNSSRAKCIKCGYCSMYFSPNKFIFHSHRTPDAKYTQPDA ANFNSWRRHLKLSDKSATDELSHAWEDVKAMFN
c-SKI_SMAD_bindc-SKI Smad4 binding domain |
---|
SMART accession number: | SM01046 |
---|---|
Description: | c-SKI is an oncoprotein that inhibits TGF-beta signaling through interaction with Smad proteins (PUBMED:15107821). This domain binds to Smad4 (PUBMED:12419246) . |
Interpro abstract (IPR014890): | This entry represents the SMAD4-binding domain of c-SKI, which is an oncogene that inhibits TGF-beta signalling through interaction with SMAD proteins [ (PUBMED:15107821) (PUBMED:12419246) ]. |
GO function: | SMAD binding (GO:0046332) |
Family alignment: |
There are 1959 c-SKI_SMAD_bind domains in 1955 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)