The domain within your query sequence starts at position 180 and ends at position 272; the E-value for the c-SKI_SMAD_bind domain shown below is 2.48e-56.

AFDVVHECAWGSRGSFIPARYNSSRAKCIKCGYCSMYFSPNKFIFHSHRTPDAKYTQPDA
ANFNSWRRHLKLSDKSATDELSHAWEDVKAMFN

c-SKI_SMAD_bind

c-SKI Smad4 binding domain
c-SKI_SMAD_bind
SMART accession number:SM01046
Description: c-SKI is an oncoprotein that inhibits TGF-beta signaling through interaction with Smad proteins (PUBMED:15107821). This domain binds to Smad4 (PUBMED:12419246) .
Interpro abstract (IPR014890):

This entry represents the SMAD4-binding domain of c-SKI, which is an oncogene that inhibits TGF-beta signalling through interaction with SMAD proteins [ (PUBMED:15107821) (PUBMED:12419246) ].

GO function:SMAD binding (GO:0046332)
Family alignment:
View or

There are 1959 c-SKI_SMAD_bind domains in 1955 proteins in SMART's nrdb database.

Click on the following links for more information.