The domain within your query sequence starts at position 792 and ends at position 843; the E-value for the cwf21 domain shown below is 6.31e-17.

MSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREK

cwf21

cwf21
SMART accession number:SM01115
Description: The cwf21 family is involved in mRNA splicing. It has been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe ((PUBMED:11884590)). The function of the cwf21 domain is to bind directly to the spliceosomal protein Prp8. Mutations in the cwf21 domain prevent Prp8 from binding ((PUBMED:19854871)). The structure of this domain has recently been solved which shows this domain to be composed of two alpha helices.
Interpro abstract (IPR013170):

The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ (PUBMED:11884590) ]. In yeast, this domain binds the protein Prp8p [ (PUBMED:19854871) ], a large and highly conserved U5 snRNP protein which has been proposed as a protein cofactor at the spliceosomal catalytic centre [ (PUBMED:11017191) ].

The cwf21 domain is found in, amongst others, the small Cwc21p protein in yeast as well as in the much larger human ortholog SRm300 (serine/arginine repetitive matrix protein).

Family alignment:
View or

There are 2663 cwf21 domains in 2663 proteins in SMART's nrdb database.

Click on the following links for more information.