The domain within your query sequence starts at position 233 and ends at position 282; the E-value for the tRNA_SAD domain shown below is 1.15e-10.
ATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVS
tRNA_SADThreonyl and Alanyl tRNA synthetase second additional domain |
---|
SMART accession number: | SM00863 |
---|---|
Description: | The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain. |
Interpro abstract (IPR012947): | The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain [ (PUBMED:10319817) ]. |
GO process: | tRNA aminoacylation (GO:0043039) |
GO function: | ATP binding (GO:0005524), aminoacyl-tRNA ligase activity (GO:0004812) |
Family alignment: |
There are 57173 tRNA_SAD domains in 57163 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)