The GIT domain within your query sequence starts at position 268 and ends at position 298, and its E-value is 4.96e-10.

AKKKLQSLSNHLFEELAMDVYDEVDRRETDA
GIT

GIT

Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins
SMART ACC:SM000555
Description:Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins, and in yeast Spa2p and Sph1p (CPP; unpublished results). In p95-APP1 the N-terminal GIT motif might be involved in binding PIX.
InterPro ACC:IPR013724
InterPro abstract:

This entry represents the Spa2 homology domain (SHD) domain found in the yeast Spa2/Sph1 protein and the mammalian GIT proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 024 GIT domains in 1 498 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GIT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GIT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GIT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GIT domain which could be assigned to a KEGG orthologous group, and not all proteins containing GIT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013724