The Nfu_N domain within your query sequence starts at position 3 and ends at position 90, and its E-value is 1.91e-48.

AAERAWGAAVGVVRLCRRFCHVATPHTFKKQPLHQYVRRPLFPLRAPLCNTVRFMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPA
Nfu_N

Nfu_N

Scaffold protein Nfu/NifU N terminal
SMART ACC:SM000932
Description:This domain is found at the N terminus of NifU and NifU related proteins, and in the human Nfu protein. Both of these proteins are thought to be involved in the the assembly of iron-sulphur clusters (PUBMED:12886008).
InterPro ACC:IPR014824
InterPro abstract:

Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] [ PUBMED:16221578 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 709 Nfu_N domains in 7 015 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Nfu_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Nfu_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Nfu_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Nfu_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Nfu_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamNfu_N
InterProIPR014824