The Dak2 domain within your query sequence starts at position 398 and ends at position 571, and its E-value is 1.47e-58.

AAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLSRLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWKSPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYISSAQLDQPDPGAVAAAAIFRAILE
Dak2

Dak2

SMART ACC:SM001120
Description:This domain is the predicted phosphatase domain of the dihydroxyacetone kinase family.
InterPro ACC:IPR004007
InterPro abstract:

Dihydroxyacetone (Dha) kinases are a family of sequence-conserved enzymes that phosphorylate dihydroxyacetone, glyceraldehyde and other short-chain ketoses and aldoses. They can be divided into two groups according to the source of high-energy phosphate that they utilise, either ATP or phosphoenolpyruvate (PEP). The ATP-dependent forms are the two-domain Dha kinases (DAK), which occur in animals … expand

GO process:glycerol metabolic process (GO:0006071)
GO function:glycerone kinase activity (GO:0004371)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 627 Dak2 domains in 19 624 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Dak2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Dak2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Dak2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Dak2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004007
PfamDak2