The Cadherin_pro domain within your query sequence starts at position 29 and ends at position 111, and its E-value is 2.61e-41.

ACQKVSLHVPSHLKAETPVGKVNLEECLKSPSLILSSDPAFRILEDGTIYTTHDLLLSSEKRGFSILLSDGQGQEQKKLEVVL
Cadherin_pro

Cadherin_pro

Cadherin prodomain like
SMART ACC:SM001055
Description:Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions (PUBMED:15130472).
InterPro ACC:IPR014868
InterPro abstract:

Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. The folded part of the prosequence (termed the prodomain) shows structural resemblance to cadherin adhesive domains, but lacks all the features known to be important for cadherin-cadherin interactions [ PUBMED:15130472 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 917 Cadherin_pro domains in 1 912 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cadherin_pro domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cadherin_pro domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the Cadherin_pro domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cadherin_pro domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cadherin_pro domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014868
PfamCadherin_pro