The CYCc domain within your query sequence starts at position 787 and ends at position 982, and its E-value is 2.68e-107.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 97222132 ) for details.

AERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISKMALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHMSSSTITILKRTDCQFLYEV
CYCc

CYCc

Adenylyl- / guanylyl cyclase, catalytic domain
SMART ACC:SM000044
Description:Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.
InterPro ACC:IPR001054
InterPro abstract:

Guanylate cyclases ( EC:4.6.1.2 ) catalyse the formation of cyclic GMP (cGMP) from GTP. cGMP acts as an intracellular messenger, activating cGMP-dependent kinases and regulating cGMP-sensitive ion channels. The role of cGMP as a second messenger in vascular smooth muscle relaxation and retinal photo-transduction is well established. … expand

GO process:intracellular signal transduction (GO:0035556), cyclic nucleotide biosynthetic process (GO:0009190)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 67 904 CYCc domains in 62 634 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CYCc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CYCc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:CAMP-synthesis, cGMP-synthesis

Relevant references for this domain

Primary literature for the CYCc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CYCc domain.

ProteinDescriptionDisease / phenotype
GUC2D_HUMANOMIM:601777 : Cone dystrophy, progressive
OMIM:600179 : Leber congenital amaurosis, type I
OMIM:204000 : Cone-rod dystrophy 6
OMIM:601777 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CYCc domain which could be assigned to a KEGG orthologous group, and not all proteins containing CYCc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamguanylate_cyc
InterProIPR001054