The RPOL8c domain within your query sequence starts at position 2 and ends at position 147, and its E-value is 5.28e-93.

AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKK
RPOL8c

RPOL8c

RNA polymerase subunit 8
SMART ACC:SM000658
Description:subunit of RNA polymerase I, II and III
InterPro ACC:IPR005570
InterPro abstract:

This family includes DNA-directed RNA polymerases I, II, and III subunit RPABC3 (also known as Rpb8), an essential subunit common to the three RNA polymerases, pol I, II and III [ PUBMED:24153182 PUBMED:16632472 ]. Rpb8 interacts with the largest … expand

GO process:DNA-templated transcription (GO:0006351)
GO function:DNA-directed RNA polymerase activity (GO:0003899)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 134 RPOL8c domains in 1 133 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOL8c domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOL8c domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOL8c domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOL8c domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOL8c domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005570