The PROF domain within your query sequence starts at position 2 and ends at position 140, and its E-value is 2.45e-55.

AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
PROF

PROF

Profilin
SMART ACC:SM000392
Description:Binds actin monomers, membrane polyphosphoinositides and poly-L-proline.
InterPro ACC:IPR005455
InterPro abstract:

This entry represents the Profilin family, which are small eukaryotic proteins that have different functions. In plants, they are major allergens present in pollens [ PUBMED:21458043 ].

The majority of the Profilin family members binds to monomeric actin (G-actin) in a 1:1 ratio thus preventing the polymerisation … expand

GO function:actin binding (GO:0003779)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 685 PROF domains in 1 683 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PROF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PROF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PROF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PROF domain which could be assigned to a KEGG orthologous group, and not all proteins containing PROF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPROFILIN
InterProIPR005455
Pfamprofilin