The PBPe domain within your query sequence starts at position 458 and ends at position 810, and its E-value is 1.01e-82.

ALFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKM
PBPe

PBPe

Eukaryotic homologues of bacterial periplasmic substrate binding proteins.
SMART ACC:SM000079
Description:Prokaryotic homologues are represented by a separate alignment: PBPb
InterPro ACC:IPR001320
InterPro abstract:

There are three classes of ionotropic glutamate receptors (iGluRs), namely NMDA (N-methyl-D-aspartate), AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole-4-propionic acid) and kainate receptors. They are believed to play critical roles in synaptic plasticity. At many synapses in the brain, transient activation of NMDA receptors leads to a persistent modification in the strength of synaptic transmission … expand

GO component:membrane (GO:0016020)
GO function:ligand-gated monoatomic ion channel activity (GO:0015276)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 693 PBPe domains in 11 580 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PBPe domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PBPe domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PBPe domain which could be assigned to a KEGG orthologous group, and not all proteins containing PBPe domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001320