The SCY domain within your query sequence starts at position 29 and ends at position 87, and its E-value is 6.53e-9.

AMSCCPNFSYYVIPWSWVYSYKFTDKSCTSDGVIFFTKTGKQFCVQPGAKWVQRFISLV
SCY

SCY

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC).
SMART ACC:SM000199
Description:Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.
InterPro ACC:IPR001811
InterPro abstract:

Many low-molecular weight factors secreted by cells including fibroblasts, macrophages and endothelial cells, in response to a variety of stimuli such as growth factors, interferons, viral transformation and bacterial products, are structurally related [ PUBMED:1910690 PUBMED:2149646 expand

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:chemokine activity (GO:0008009)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 048 SCY domains in 8 975 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SCY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SCY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SCY domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SCY domain which could be assigned to a KEGG orthologous group, and not all proteins containing SCY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamil8
InterProIPR001811
PROSITESCY_DOMAIN