The BIR domain within your query sequence starts at position 276 and ends at position 347, and its E-value is 2.14e-32.

ANEELRMDMFKDWPQESPVGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQT
BIR

BIR

Baculoviral inhibition of apoptosis protein repeat
SMART ACC:SM000238
Description:Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
InterPro ACC:IPR001370
InterPro abstract:

The BIR domain has a fold that is stabilised by zinc tetrahedrally coordinated by one histidine and three cysteine residues. The structure consists of three short α-helices and turns with the zinc packed in an unusually hydrophobic environment created by residues that are highly conserved among all BIRs. A subclass of repeats, comprising those at the C terminus of a series of BIR repeats from … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 317 BIR domains in 5 952 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BIR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BIR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Caspase-inhibiting

Relevant references for this domain

Primary literature for the BIR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BIR domain which could be assigned to a KEGG orthologous group, and not all proteins containing BIR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEBIR_REPEAT
InterProIPR001370
PfamBIR