The BIR domain within your query sequence starts at position 276 and ends at position 347, and its E-value is 7.82e-26.

ANEELRMDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFPNCVFLQT

BIR Baculoviral inhibition of apoptosis protein repeat
SMART ACC:	SM000238
Description:	Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
InterPro ACC:	IPR001370
InterPro abstract:	The BIR domain has a fold that is stabilised by zinc tetrahedrally coordinated by one histidine and three cysteine residues. The structure consists of three short α-helices and turns with the zinc packed in an unusually hydrophobic environment created by residues that are highly conserved among all BIRs. A subclass of repeats, comprising those at the C terminus of a series of BIR repeats from … expand The BIR domain has a fold that is stabilised by zinc tetrahedrally coordinated by one histidine and three cysteine residues. The structure consists of three short α-helices and turns with the zinc packed in an unusually hydrophobic environment created by residues that are highly conserved among all BIRs. A subclass of repeats, comprising those at the C terminus of a series of BIR repeats from IAP proteins bearing RING finger domains, are likely to contain a C-terminal region that form an α-helix [ PUBMED:10404221 ]. Proteins that are known to contain this domain include: Baculoviruses apoptosis inhibitors (IAPs). Mammalian apoptosis inhibitors 1 and 2 (IAP1 and IAP2; BIRC-2 and BIRC-3; MEROPS identifiers I32.002 and I32.003, respectively). Mammalian X-linked inhibitor of apoptosis protein (X-linked IAP; MEROPS identifier I32.004). Chicken IAP (ITA). Human neuronal apoptosis inhibitory protein (NAIP, BIRC-1; MEROPS identifier I32.001). Drosophila apoptosis inhibitors 1 and 2 (Iap1 and Iap2; MEROPS identifiers I32.009 and I32.011, respectively)). African Swine Fever Virus (ASFV) protein p27. The 'baculovirus inhibitior of apoptosis protein repeat' (BIR) [ PUBMED:8139034 PUBMED:8552191 ] is a domain of about 70 residues arranged in tandem repeats separated by a variable length linker, that seems to confer cell death-preventing activity. It is found in proteins belonging to the IAP (inhibitor of apoptosis proteins) family. The critical motifs required for anti-apoptotic activity of IAP proteins are the BIRs. All IAP proteins contain from one to three BIRs, and all known interactions between IAPs and other proteins are mediated by one or more BIRs [ PUBMED:10404221 ]. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. Proteins with BIR domains are considered peptidase inhibitors in family I32. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger [ PUBMED:8445726 ]. collapse
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 10 317 BIR domains in 5 952 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BIR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BIR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:	Signalling
Binding / catalysis:	Caspase-inhibiting

Relevant references for this domain

Primary literature for the BIR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BIR domain which could be assigned to a KEGG orthologous group, and not all proteins containing BIR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE	BIR_REPEAT
InterPro	IPR001370
Pfam	BIR