The AlaDh_PNT_C domain within your query sequence starts at position 208 and ends at position 375, and its E-value is 1.27e-39.

ANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGGFLVTQRMLDMFKRPTDPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLG
AlaDh_PNT_C

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain
SMART ACC:SM001002
Description:Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine.
InterPro ACC:IPR007698
InterPro abstract:

Alanine dehydrogenase catalyses the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyses the reduction of NADP + to NADPH with the concomitant oxidation of NADH to NAD +. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 178 AlaDh_PNT_C domains in 28 174 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AlaDh_PNT_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AlaDh_PNT_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the AlaDh_PNT_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AlaDh_PNT_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing AlaDh_PNT_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAlaDh_PNT_C
InterProIPR007698