The Aamy_C domain within your query sequence starts at position 422 and ends at position 510, and its E-value is 4.02e-49.

ANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTGLPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESK
Aamy_C

Aamy_C

SMART ACC:SM000632
Description: -
InterPro ACC:IPR031319
InterPro abstract:

Alpha-amylase is classified as family 13 of the glycosyl hydrolases and is present in archaea, bacteria, fungi, plants and animals. Alpha-amylase is an essential enzyme in alpha-glucan metabolism, acting to catalyse the hydrolysis of alpha-1,4-glucosidic bonds of glycogen, starch and related polysaccharides. Although all alpha-amylases possess the same catalytic function, they can vary with … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 203 Aamy_C domains in 4 158 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Aamy_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Aamy_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Aamy_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Aamy_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamalpha-amylase_C
InterProIPR031319