The VRR_NUC domain within your query sequence starts at position 896 and ends at position 1011, and its E-value is 1.99e-37.

APAESLRAWVGEAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVA
VRR_NUC

VRR_NUC

SMART ACC:SM000990
Description:This entry contains proteins with the VRR-NUC domain. It is associated with members of the PD-(D/E)XK nuclease superfamily, which include the type III restriction modification enzymes, for example StyLTI.
InterPro ACC:IPR014883
InterPro abstract:

This entry contains proteins with the VRR-NUC domain, such as FAN1, a structure-selective DNA repair nuclease with 5' flap endonuclease activity, involved in the repair of interstrand DNA crosslinks. FAN1 is the only eukaryotic protein with a VRR-NUC domain [ PUBMED:24981866 PUBMED:25430771 expand

GO function:hydrolase activity, acting on ester bonds (GO:0016788)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 433 VRR_NUC domains in 7 432 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VRR_NUC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VRR_NUC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the VRR_NUC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VRR_NUC domain which could be assigned to a KEGG orthologous group, and not all proteins containing VRR_NUC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014883
PfamVRR_NUC