The COLIPASE domain within your query sequence starts at position 19 and ends at position 113, and its E-value is 1.56e-62.

APGPRGLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ
COLIPASE

COLIPASE

Colipase
SMART ACC:SM000023
Description: Colipase is a protein that functions as a cofactor for pancreatic lipase, with which it forms a stoichiometric complex. It also binds to the bile-salt covered triacylglycerol interface thus allowing the enzyme to anchor itself to the water-lipid interface. Colipase is a small protein of approximately 100 amino-acid residues with five conserved disulfide bonds.
InterPro ACC:IPR001981
InterPro abstract:

Colipase [ PUBMED:1567900 PUBMED:3147715 ] is a small protein cofactor needed by pancreatic lipase for efficient dietary lipid hydrolyisis. It also binds to the bile-salt covered triacylglycerol interface, thus allowing the enzyme to anchor itself … expand

GO process:digestion (GO:0007586), lipid catabolic process (GO:0016042)
GO component:extracellular region (GO:0005576)
GO function:enzyme activator activity (GO:0008047)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 92 COLIPASE domains in 92 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing COLIPASE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing COLIPASE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the COLIPASE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a COLIPASE domain which could be assigned to a KEGG orthologous group, and not all proteins containing COLIPASE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00121
InterProIPR001981