The Pept_C1 domain within your query sequence starts at position 249 and ends at position 460, and its E-value is 4.2e-93.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 20480081 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
17265QNo
23271CNo
N/AN/AHNo
APPEWDWRKKGAVTEVKNQGMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQELLDCDKVDKACLGGLPSNAYAAIKNLGGLETEDDYGYQGHVQTCNFSAQMAKVYINDSVELSRNENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRSNIPYWAIKNSWGSDWGEEGYYYLYRGSGACGVNTMASSAV
Pept_C1

Pept_C1

Papain family cysteine protease
SMART ACC:SM000645
Description: -
InterPro ACC:IPR000668
InterPro abstract:

This entry represents the papain C-terminal of a group of proteins that belong to the cysteine peptidase family C1, sub-family C1A (papain family, clan CA).

A cysteine peptidase is a proteolytic enzyme that hydrolyses a peptide bond using the thiol group of a cysteine residue as a nucleophile. Hydrolysis involves usually a catalytic triad consisting of the thiol group of the cysteine … expand

GO process:proteolysis (GO:0006508)
GO function:cysteine-type peptidase activity (GO:0008234)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 688 Pept_C1 domains in 19 347 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Pept_C1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Pept_C1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Pept_C1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Pept_C1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPeptidase_C1
InterProIPR000668